PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do014473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family bZIP
Protein Properties Length: 282aa    MW: 30340.9 Da    PI: 5.0715
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do014473.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.13.3e-17118171356
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                 e kr rr+ +NRe+ArrsR+RK+a++  Le  v++L++eN +L k+l+e +++ 
  Do014473.1 118 ETKRIRRMVSNRESARRSRRRKQAQLTDLESQVEQLKGENATLFKQLSEANQQF 171
                 679*****************************************9888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.9E-17116180IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.461118170IPR004827Basic-leucine zipper domain
PfamPF001707.8E-15118170IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-12120172No hitNo description
Gene3DG3DSA:1.20.5.1704.9E-14120171No hitNo description
PROSITE patternPS000360123138IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MKKCPSELQL EAFIRENGEG AGAGQSKPES GPSEPGGSGV FSPGGIGFGD TNTMDGSSWW  60
FGSMLPANPV LLQTASISAS PRATTSANHA LESESDSDSE SLYEVDEGSC ERGTKSMETK  120
RIRRMVSNRE SARRSRRRKQ AQLTDLESQV EQLKGENATL FKQLSEANQQ FTTAVTDNRI  180
LKSDVEALRV KVKMAEDMVA RSAMSCGLGD LGLAPYLNSR KMCQALNMLT VTGLDLLGSD  240
AFRGPTAARQ IQNSPVQSTA SLESLDNRKS SEVTSCAADM WP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132139RRSRRRKQ
2134139SRRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965642.11e-174PREDICTED: basic leucine zipper 9
TrEMBLK3XYN51e-174K3XYN5_SETIT; Uncharacterized protein
STRINGSi007043m1e-173(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.12e-29basic leucine zipper 9